PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN25721.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 476aa    MW: 53830 Da    PI: 8.8395
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN25721.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.58.7e-205397348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rWT+eEd+ll + vk++ g++Wk+Ia++++ gRt+ qc +rwqk+l
       KHN25721.1 53 RWTEEEDKLLSEKVKKHNGRNWKKIAAYLP-GRTDVQCLHRWQKVL 97
                     9*****************************.************986 PP

2Myb_DNA-binding55.41.4e-17103149148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+ Ed++l+++v+++G ++W  Ia++++ gR +kqc++rw+++l
       KHN25721.1 103 KGSWTKKEDDRLIELVRKYGIKRWFFIAKYLP-GRIGKQCRERWHNHL 149
                      799*****************************.*************97 PP

3Myb_DNA-binding50.26.1e-16155197145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE+++l+ + + +G++ W+ Iar ++ gRt++ +k++w+
       KHN25721.1 155 KDAWTEEEELILAYYYQIYGSK-WAEIARILP-GRTDNAIKNHWN 197
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2374697IPR017930Myb domain
SMARTSM007173.0E-165099IPR001005SANT/Myb domain
SuperFamilySSF466892.48E-1650104IPR009057Homeodomain-like
PfamPF002493.0E-175397IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2253107IPR009057Homeodomain-like
CDDcd001679.77E-155397No hitNo description
PROSITE profilePS5129430.61398153IPR017930Myb domain
SuperFamilySSF466899.36E-31100196IPR009057Homeodomain-like
SMARTSM007173.3E-17102151IPR001005SANT/Myb domain
PfamPF002491.1E-16103149IPR001005SANT/Myb domain
CDDcd001671.76E-15105149No hitNo description
Gene3DG3DSA:1.10.10.607.6E-26108155IPR009057Homeodomain-like
SMARTSM007171.7E-14154202IPR001005SANT/Myb domain
PROSITE profilePS5129417.567154204IPR017930Myb domain
PfamPF002492.4E-13155197IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-21156204IPR009057Homeodomain-like
CDDcd001671.11E-10157197No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MLEVKKELND FNFDSRLPDG LNLCFSSSPN CNTDTFLQES TPIAGTTKAR ARRWTEEEDK  60
LLSEKVKKHN GRNWKKIAAY LPGRTDVQCL HRWQKVLNPD LVKGSWTKKE DDRLIELVRK  120
YGIKRWFFIA KYLPGRIGKQ CRERWHNHLD PTVKKDAWTE EEELILAYYY QIYGSKWAEI  180
ARILPGRTDN AIKNHWNCSM KKKLDASPLG CDIKVASSGF CASGIRPEHV VAKVEGQSFN  240
GMVSPKQSHW LNRSVDNILT KLILQNDSGE ESCSASSRGT PTPRASRQFL DNSLDCLPLS  300
STVTDEAYES LKRQKVYFSD TELKVGDESD SPLLNLSYSK SANREKKGQA GNGGNYNSNN  360
TMPHSVDEFS ECLSPKTHMA LACAYNNGCT PPTSILKNDT GDINPETLLR NLAMTYENVP  420
SIIRKRTPKK ASCCDRDQAP SRMIVNSPEA ECVIGLDNLK LNRGFIPFLR RPNTQP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-68532048159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-68532048159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516693.10.0PREDICTED: myb-related protein B-like
TrEMBLA0A0B2QVS00.0A0A0B2QVS0_GLYSO; Myb-related protein 3R-1
STRINGGLYMA01G42650.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133012528
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.23e-78myb domain protein 3r-5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]